Research use only
Sermorelin Acetate
For research use only. Not for human or animal use.
FOR RESEARCH USE ONLY. NOT FOR HUMAN OR ANIMAL USE. This product is not a drug, food, cosmetic, or dietary supplement, and has not been evaluated or approved by the FDA for any use other than laboratory research. Not for diagnostic or therapeutic use. Sale is restricted to qualified research professionals and institutions.
What it is
This row is the research solid of GHRH(1-29) amide as the acetate salt. A finished drug product was previously marketed under this name and later withdrawn from that market. The catalog listing is not that finished product.
Structure and sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2.
Molecular weight
The free-peptide mass is near 3358 Da. Acetate content changes the salt mass and is not a purity figure.
What published research models study
It is studied as a GHRH-receptor ligand. The certificate of analysis is the identity document for acetate content and peptide mass.
No single peer-reviewed monograph is cited for this catalog name. Identity for a lot is the certificate of analysis.
Storage and handling
Supplied as a lyophilized solid in a sealed vial unless the catalog row states another format. Recommended storage is −20 °C. Trained laboratory personnel should handle the vial with appropriate personal protective equipment. Identity, purity, salt form, and lot-specific notes belong on the certificate of analysis, which is available on request.
Catalog listing
Sermorelin Acetate in the research catalog
Latest published studies · How certificates are handled