Research use only
VIP
For research use only. Not for human or animal use.
FOR RESEARCH USE ONLY. NOT FOR HUMAN OR ANIMAL USE. This product is not a drug, food, cosmetic, or dietary supplement, and has not been evaluated or approved by the FDA for any use other than laboratory research. Not for diagnostic or therapeutic use. Sale is restricted to qualified research professionals and institutions.
What it is
VIP is a defined neuropeptide supplied for receptor research. Published work includes receptor pharmacology and in-vitro second-messenger assays.
Structure and sequence
HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2.
Molecular weight
Mass near 3326 Da.
What published research models study
The peptide is a class B GPCR ligand shared in part with pituitary adenylate cyclase-activating peptide. That is receptor identity, not a use claim.
No single peer-reviewed monograph is cited for this catalog name. Identity for a lot is the certificate of analysis.
Storage and handling
Supplied as a lyophilized solid in a sealed vial unless the catalog row states another format. Recommended storage is −20 °C. Trained laboratory personnel should handle the vial with appropriate personal protective equipment. Identity, purity, salt form, and lot-specific notes belong on the certificate of analysis, which is available on request.
Catalog listing
Latest published studies · How certificates are handled